Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TCP1-delta Rabbit anti-Human, Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | TCP1-delta |
---|---|
Dilution | Western Blot 1.0 ug/ml, Immunohistochemistry |
Applications | Western Blot, Immunohistochemistry |
Classification | Polyclonal |
Conjugate | Unconjugated |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NB125535
|
Novus Biologicals
NBP310317100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
TCP1-delta Polyclonal specifically detects TCP1-delta in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry.Specifications
TCP1-delta | |
Western Blot, Immunohistochemistry | |
Unconjugated | |
Rabbit | |
Cell Cycle and Replication | |
PBS buffer, 2% sucrose | |
10575 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot 1.0 ug/ml, Immunohistochemistry | |
Polyclonal | |
Purified | |
RUO | |
Human, Rat | |
CCTD, CCT-DELTA, chaperonin containing t-complex polypeptide 1, delta subunit, chaperonin containing TCP1, subunit 4 (delta), MGC126165, SRBMGC126164, Stimulator of TAR RNA-binding, T-complex protein 1 subunit delta, TCP-1-delta | |
The immunogen is a synthetic peptide directed towards the C terminal region of human TCP1-delta (NP_006421). Peptide sequence AFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKGGISN | |
Affinity purified |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title