Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TCP10 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | TCP10 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP155165
|
Novus Biologicals
NBP155165 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
TCP10 Polyclonal specifically detects TCP10 in Human samples. It is validated for Western Blot.Specifications
| TCP10 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q12799 | |
| 6953 | |
| Synthetic peptides corresponding to TCP10(t-complex 10 homolog (mouse)) The peptide sequence was selected from the middle region of TCP10. Peptide sequence ERINSGKTPPQEDREKSPPGRRQDRSPAPTGRPTPGAERRGVSEDGKIMH. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| MGC34049, t-complex 10 (a murine tcp homolog), t-complex 10 (mouse), t-complex 10 homolog (mouse), T-complex protein 10A homolog, TCP10A | |
| TCP10 | |
| IgG | |
| Affinity Purified | |
| 35 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title