Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TCP10 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen TCP10
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP155165
View Documents
Novus Biologicals
NBP155165
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

TCP10 Polyclonal specifically detects TCP10 in Human samples. It is validated for Western Blot.
Specifications

Specifications

TCP10
Polyclonal
Rabbit
Human
Q12799
6953
Synthetic peptides corresponding to TCP10(t-complex 10 homolog (mouse)) The peptide sequence was selected from the middle region of TCP10. Peptide sequence ERINSGKTPPQEDREKSPPGRRQDRSPAPTGRPTPGAERRGVSEDGKIMH.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
MGC34049, t-complex 10 (a murine tcp homolog), t-complex 10 (mouse), t-complex 10 homolog (mouse), T-complex protein 10A homolog, TCP10A
TCP10
IgG
Affinity Purified
35 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit