Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TCTA Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$149.00 - $329.00
Specifications
| Antigen | TCTA |
|---|---|
| Immunogen | Synthetic peptides corresponding to TCTA(T-cell leukemia translocation altered gene) The peptide sequence was selected from the middle region of TCTA. Peptide sequence IQLAWGFYGNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKTHR. |
| Host Species | Rabbit |
| Primary or Secondary | Primary |
| Monoclonal or Polyclonal | Polyclonal |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
| NBP15982820 |
Novus Biologicals
NBP15982820UL |
20ul |
Each for $149.00
|
|
NBP159828 |
Novus Biologicals
NBP159828 |
100 ul |
Each for $329.00
|
|
Description
TCTA Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.Specifications
| TCTA | |
| Rabbit | |
| Polyclonal | |
| Unconjugated | |
| 6988 | |
| Affinity Purified | |
| Western Blot | |
| RUO |
| Synthetic peptides corresponding to TCTA(T-cell leukemia translocation altered gene) The peptide sequence was selected from the middle region of TCTA. Peptide sequence IQLAWGFYGNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKTHR. | |
| Primary | |
| IgG | |
| T-cell leukemia translocation altered gene, T-cell leukemia translocation-altered gene protein, T-cell leukemia translocation-associated gene protein | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Immunogen affinity purified | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title