Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TCTA Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | TCTA |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP159828
|
Novus Biologicals
NBP159828 |
100 μL |
Each of 1 for $436.00
|
|
Description
TCTA Polyclonal specifically detects TCTA in Human samples. It is validated for Western Blot.Specifications
TCTA | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
T-cell leukemia translocation altered gene, T-cell leukemia translocation-altered gene protein, T-cell leukemia translocation-associated gene protein | |
TCTA | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
P57738 | |
6988 | |
Synthetic peptides corresponding to TCTA(T-cell leukemia translocation altered gene) The peptide sequence was selected from the middle region of TCTA. Peptide sequence IQLAWGFYGNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKTHR. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title