Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TCTE1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | TCTE1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156639
|
Novus Biologicals
NBP156639 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
TCTE1 Polyclonal specifically detects TCTE1 in Human samples. It is validated for Western Blot.Specifications
| TCTE1 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| D6S46, FLJ50041, MGC33600, T-complex-associated testis-expressed protein 1, t-complex-associated-testis-expressed 1, tcte-1 | |
| TCTE1 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q5JU00 | |
| 202500 | |
| Synthetic peptides corresponding to TCTE1(t-complex-associated-testis-expressed 1) The peptide sequence was selected from the middle region of TCTE1. Peptide sequence MNFEWNLFLFTYRDCLSLAAAIKACHTLKIFKLTRSKVDDDKARIIIRSL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title