Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TCTEX1D4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP170719
Description
TCTEX1D4 Polyclonal specifically detects TCTEX1D4 in Human samples. It is validated for Western Blot.Specifications
TCTEX1D4 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
Tctex1 domain containing 4 | |
Rabbit | |
Affinity Purified | |
RUO | |
343521 | |
Human, Rat | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
TCTEX1D4 | |
Synthetic peptides corresponding to RP11-269F19.9 (Tctex1 domain containing 4) The peptide sequence was selected from the middle region of RP11-269F19.9. Peptide sequence VCSVVLGPRAGQGVHVVSRALWDVARDGLASVSYTNTSLFAVATVHGLYC. | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title