Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TCTN3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | TCTN3 |
---|---|
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Regulatory Status | RUO |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP159741
|
Novus Biologicals
NBP159741 |
100 μL |
Each of 1 for $436.00
|
|
Description
TCTN3 Polyclonal specifically detects TCTN3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
TCTN3 | |
Unconjugated | |
RUO | |
Q6NUS6 | |
26123 | |
Synthetic peptides corresponding to TCTN3(tectonic family member 3) The peptide sequence was selected from the middle region of TCTN3. Peptide sequence LTYFPKWSVISLLRQPAGVGAGGLCAESNPAGFLESKSTTCTRFFKNLAS. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
C10orf61, chromosome 10 open reading frame 61, DKFZP564D116, TECT3DKFZp564D116, tectonic 3, tectonic family member 3, tectonic-3 | |
TCTN3 | |
IgG | |
Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title