Testican 3/SPOCK3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159703

Catalog No. NBP159703

Description

Testican 3/SPOCK3 Polyclonal specifically detects Testican 3/SPOCK3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Testican 3/SPOCK3
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9BQ16-1
• Gene Symbols: SPOCK3
• Immunogen: Synthetic peptides corresponding to SPOCK3(sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3) The peptide sequence was selected from the middle region of SPOCK3. Peptide sequence VDRYGNEVMGSRINGVADCAIDFEISGDFASGDFHEWTDDEDDEDDIMND The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CWCV, and Kazal-like domains proteoglycan 3, HSAJ1454, sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3, TES-3, testican 3, TICN3
• Host Species: Rabbit
• Molecular Weight of Antigen: 49 kDa
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 50859
• Target Species: Human, Mouse, Rat, Porcine, Canine, Guinea Pig, Rabbit
• Isotype: IgG