Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Testis expressed 264 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | Testis expressed 264 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP162424
|
Novus Biologicals
NBP162424 |
100 μL |
Each of 1 for $436.00
|
|
Description
Testis expressed 264 Polyclonal specifically detects Testis expressed 264 in Human samples. It is validated for Western Blot.Specifications
Testis expressed 264 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
DKFZp451H0417, Putative secreted protein Zsig11, SIG11, testis expressed 264, testis expressed gene 264, testis expressed sequence 264, testis-expressed sequence 264 protein, ZSIG11FLJ13935 | |
TEX264 | |
IgG | |
Affinity Purified | |
34 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q9Y6I9 | |
51368 | |
Synthetic peptides corresponding to TEX264(testis expressed 264) The peptide sequence was selected from the middle region of TEX264. Peptide sequence GWDDGDTRSEHSYSESGASGSSFEELDLEGEGPLGESRLDPGTEPLGTTK. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title