Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Testis expressed 264 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen Testis expressed 264
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP162424
View Documents
Novus Biologicals
NBP162424
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

Testis expressed 264 Polyclonal specifically detects Testis expressed 264 in Human samples. It is validated for Western Blot.
Specifications

Specifications

Testis expressed 264
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
DKFZp451H0417, Putative secreted protein Zsig11, SIG11, testis expressed 264, testis expressed gene 264, testis expressed sequence 264, testis-expressed sequence 264 protein, ZSIG11FLJ13935
TEX264
IgG
Affinity Purified
34 kDa
Western Blot
Unconjugated
RUO
Q9Y6I9
51368
Synthetic peptides corresponding to TEX264(testis expressed 264) The peptide sequence was selected from the middle region of TEX264. Peptide sequence GWDDGDTRSEHSYSESGASGSSFEELDLEGEGPLGESRLDPGTEPLGTTK.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit