Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TEX10 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | TEX10 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB123421
|
Novus Biologicals
NBP309260100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
TEX10 Polyclonal specifically detects TEX10 in Human samples. It is validated for Western Blot.Specifications
| TEX10 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| bA208F1.2, FLJ20287, FLJ31157, FLJ34350, testis expressed 10, testis expressed gene 10, testis expressed sequence 10, testis-expressed sequence 10 protein | |
| The immunogen is a synthetic peptide directed towards the middle region of human TEX10 (NP_001155056.1). Peptide sequence RLTSQQWRLKVLVRLSKFLQALADGSSRLRESEGLQEQKENPHATSNSIF | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 54881 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title