Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TEX2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | TEX2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15997720
|
Novus Biologicals
NBP15997720UL |
20 μL |
Each for $152.22
|
|
NBP159977
|
Novus Biologicals
NBP159977 |
100 μL |
Each for $436.00
|
|
Description
TEX2 Polyclonal specifically detects TEX2 in Human samples. It is validated for Western Blot.Specifications
| TEX2 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| HT008, KIAA1738DKFZp781G0721, testis expressed 2, testis expressed sequence 2, testis-expressed sequence 2 protein, TMEM96, transmembrane protein 96 | |
| TEX2 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8IWB9 | |
| 55852 | |
| Synthetic peptides corresponding to TEX2(testis expressed 2) The peptide sequence was selected from the N terminal of TEX2. Peptide sequence KSLSTEVEPKESPHPARHRHLMKTLVKSLSTDTSRQESDTVSYKPPDSKL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title