Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TGDS Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | TGDS |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP157733
|
Novus Biologicals
NBP157733 |
100 μL |
Each of 1 for $436.00
|
|
Description
TGDS Polyclonal specifically detects TGDS in Human samples. It is validated for Western Blot.Specifications
TGDS | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
dTDP-D-glucose 4,6-dehydratase, EC 4.2.1.46, growth-inhibiting protein 21, P, SDR2E1, short chain dehydrogenase/reductase family 2E, member 1, TDPGD, TDP-glucose 4,6-dehydratase | |
TGDS | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
O95455 | |
23483 | |
Synthetic peptides corresponding to TGDS (TDP-glucose 4,6-dehydratase) The peptide sequence was selected from the middle region of TGDS)(50ug). Peptide sequence DEVYGGSLDKEFDESSPKQPTNPYASSKAAAECFVQSYWEQYKFPVVITR. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title