Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TGIF1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP154349

 View more versions of this product

Catalog No. NBP154349

Add to cart



TGIF1 Polyclonal antibody specifically detects TGIF1 in Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Rabbit, Sheep samples. It is validated for Western Blot.


PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
Synthetic peptides corresponding to TGIF1(TGFB-induced factor homeobox 1) The peptide sequence was selected from the C terminal of TGIF1. Peptide sequence GQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQSGLFNTPPPTPPDLN.
43 kDa
100 ul
Core ESC Like Genes, Stem Cell Markers
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Sheep
Western Blot
Western Blot 1:100-1:2000
5'-TG-3' interacting factor, homeobox protein TGIF, homeobox protein TGIF1, HPE4, MGC39747, TALE homeobox TG-interacting factor, TGFB-induced factor (TALE family homeobox), TGFB-induced factor homeobox 1, TGIFMGC5066,5'-TG-3'-interacting factor 1, transforming growth factor-beta-induced factor
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit