Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TGIF1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$157.00 - $482.50
Specifications
Antigen | TGIF1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15434920
|
Novus Biologicals
NBP15434920UL |
20 μL |
Each for $157.00
|
|
|||||
NBP154349
|
Novus Biologicals
NBP154349 |
100 μL |
Each for $482.50
|
|
|||||
Description
TGIF1 Polyclonal specifically detects TGIF1 in Human samples. It is validated for Western Blot.Specifications
TGIF1 | |
Polyclonal | |
Rabbit | |
Core ESC Like Genes, Stem Cell Markers | |
5'-TG-3' interacting factor, homeobox protein TGIF, homeobox protein TGIF1, HPE4, MGC39747, TALE homeobox TG-interacting factor, TGFB-induced factor (TALE family homeobox), TGFB-induced factor homeobox 1, TGIFMGC5066,5'-TG-3'-interacting factor 1, transforming growth factor-beta-induced factor | |
TGIF1 | |
IgG | |
43 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q15583 | |
7050 | |
Synthetic peptides corresponding to TGIF1(TGFB-induced factor homeobox 1) The peptide sequence was selected from the C terminal of TGIF1. Peptide sequence GQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQSGLFNTPPPTPPDLN. | |
Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title