Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Our pricing system is unavailable. You are viewing list price.
Please call 1-800-766-7000 to place your order or try our site again later.

TH1L Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP179691

 View more versions of this product

Catalog No. NBP179691



Description

Description

TH1L Polyclonal antibody specifically detects TH1L in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish samples. It is validated for Western Blot.
Specifications

Specifications

TH1L
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
TH1L
Synthetic peptide directed towards the N terminal of human TH1LThe immunogen for this antibody is TH1L. Peptide sequence GEGEDDAEVQQECLHKFSTRDYIMEPSIFNTLKRYFQAGGSPENVIQLLS.
66 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:1000
NP_945327
HSPC130, negative elongation factor proteins C and D, NELF-C, NELF-C/D, NELFD, NELF-D, TH1 drosophila homolog, TH1-like (Drosophila homolog), TH1-like (Drosophila), TH1-like protein, TH1negative elongation factor C/D, trihydrophobin 1
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
51497
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit