Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TH1L Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | TH1L |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179691
|
Novus Biologicals
NBP179691 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
TH1L Polyclonal specifically detects TH1L in Human samples. It is validated for Western Blot.Specifications
| TH1L | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| HSPC130, negative elongation factor proteins C and D, NELF-C, NELF-C/D, NELFD, NELF-D, TH1 drosophila homolog, TH1-like (Drosophila homolog), TH1-like (Drosophila), TH1-like protein, TH1negative elongation factor C/D, trihydrophobin 1 | |
| TH1L | |
| IgG | |
| Affinity Purified | |
| 66 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_945327 | |
| 51497 | |
| Synthetic peptide directed towards the N terminal of human TH1LThe immunogen for this antibody is TH1L. Peptide sequence GEGEDDAEVQQECLHKFSTRDYIMEPSIFNTLKRYFQAGGSPENVIQLLS. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title