THNSL2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP170723

Catalog No. NBP170723

Description

THNSL2 Polyclonal specifically detects THNSL2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: THNSL2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: THNSL2
• Immunogen: Synthetic peptides corresponding to THNSL2(threonine synthase-like 2 (S. cerevisiae)) The peptide sequence was selected from the middle region of THNSL2. Peptide sequence LPLVEVVVPTGAAGNLAAGYIAQKIGLPIRLVVAVNRNDIIHRTVQQGDF.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Equine: 100%; Human: 100%; Mouse: 100%; Bovine: 92%; Canine: 92%; Chicken: 91%; Zebrafish: 80%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: FLJ10916, FLJ35504, secreted osteoclastogenic factor of activated T cells, SOFAT, threonine synthase-like 2 (S. cerevisiae), THS2, TSH2
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55258
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.