Thrombopoietin/Tpo Rabbit anti-Canine, Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159293

Catalog No. NBP159293

Description

Thrombopoietin/THPO Polyclonal specifically detects Thrombopoietin/THPO in Human samples. It is validated for Western Blot, ELISA.

Specifications

• Antigen: Thrombopoietin/Tpo
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml, ELISA 1:100-1:2000
• Gene Accession No.: P40225
• Gene Symbols: THPO
• Immunogen: Synthetic peptides corresponding to THPO(thrombopoietin (myeloproliferative leukemia virus oncogene ligand, megakaryocyte growth and development factor)) The peptide sequence was selected from the middle region of THPO. Peptide sequence NLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTS The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Cat: 100%; Human: 100%; Canine: 83%;.
• Target Species: Human, Canine, Rabbit
• Isotype: IgG

• Applications: Western Blot, ELISA
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Megakaryocyte colony-stimulating factor, Megakaryocyte growth and development factor, megakaryocyte stimulating factor, MGDFC-mpl ligand, ML, MPL ligand, MPLLGMGC163194, Myeloproliferative leukemia virus oncogene ligand, thrombopoietin, thrombopoietin nirs variant 1, TPOMKCSF
• Host Species: Rabbit
• Molecular Weight of Antigen: 35 kDa
• Quantity: 100 μL
• Research Discipline: Cellular Markers, Cytokine Research, Hematopoietic Stem Cell Markers, Stem Cell Markers
• Gene ID (Entrez): 7066
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.