Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TIGD1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | TIGD1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP155189
|
Novus Biologicals
NBP155189 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
TIGD1 Polyclonal specifically detects TIGD1 in Human samples. It is validated for Western Blot.Specifications
| TIGD1 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| EEYORE, tigger transposable element derived 1, tigger transposable element-derived protein 1 | |
| TIGD1 | |
| IgG | |
| Affinity Purified | |
| 67 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q96MW7 | |
| 200765 | |
| Synthetic peptides corresponding to TIGD1(tigger transposable element derived 1) The peptide sequence was selected from the middle region of TIGD1. Peptide sequence SQLMRKASPMSYFRKLPQPPQPSAATTLTSQQPSTSRQDPPPAKRVRLTE. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title