TIM-3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169154

Catalog No. NBP169154

Description

TIM-3 Polyclonal specifically detects TIM-3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TIM-3
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8TDQ0
• Gene Symbols: HAVCR2
• Immunogen: Synthetic peptides corresponding to HAVCR2 (hepatitis A virus cellular receptor 2) The peptide sequence was selected from the C terminal of HAVCR2. Peptide sequence IGIYIGAGICAGLALALIFGALIFKWYSHSKEKIQNLSLISLANLPPSGL.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Canine: 82%.
• Target Species: Human, Bovine, Canine, Equine
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CD366, FLJ14428, HAVcr-2, hepatitis A virus cellular receptor 2, kidney injury molecule-3, T cell immunoglobulin mucin 3, T cell immunoglobulin mucin-3, T-cell immunoglobulin and mucin domain-containing protein 3, TIM 3, Tim-3, TIM3 T-cell membrane protein 3, TIMD-3, TIMD3KIM-3
• Host Species: Rabbit
• Molecular Weight of Antigen: 33 kDa
• Quantity: 100 μL
• Research Discipline: Cancer, Immunology, Innate Immunity, Neuroscience
• Gene ID (Entrez): 84868
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.