Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TIMM23 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen TIMM23
Dilution Western Blot 1.0 ug/ml, Adhesion Activation
Applications Western Blot, Adhesion Activation
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB124822
View Documents
Novus Biologicals
NBP30996025UL
25 μg
Each for $106.19
Add to cart
 
NB124821
View Documents
Novus Biologicals
NBP309960100UL
100 μg
Each for $352.89
Add to cart
 
Description

Description

TIMM23 Polyclonal antibody specifically detects TIMM23 in Human samples. It is validated for Western Blot, Adhesion Activation
Specifications

Specifications

TIMM23
Western Blot, Adhesion Activation
Purified
RUO
PBS buffer, 2% sucrose
100287932
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml, Adhesion Activation
Unconjugated
Rabbit
Human
bA592B15.7, MGC22767, PRO1197, RP11-592B15.7, TIM23
The immunogen is a synthetic peptide directed towards the C terminal region of human TIMM23 (NP_006318.1). Peptide sequence VAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGSLLQQ
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit