Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TIMM23 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | TIMM23 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml, Adhesion Activation |
| Applications | Western Blot, Adhesion Activation |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB124821
|
Novus Biologicals
NBP309960100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
TIMM23 Polyclonal specifically detects TIMM23 in Human samples. It is validated for Western Blot, Adhesion Activation.Specifications
| TIMM23 | |
| Western Blot, Adhesion Activation | |
| Unconjugated | |
| Rabbit | |
| Human | |
| bA592B15.7, MGC22767, PRO1197, RP11-592B15.7, TIM23 | |
| The immunogen is a synthetic peptide directed towards the C terminal region of human TIMM23 (NP_006318.1). Peptide sequence VAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGSLLQQ | |
| Affinity purified |
| Western Blot 1.0 ug/ml, Adhesion Activation | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 100287932 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title