Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TIMM44 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15438120UL

 View more versions of this product

Catalog No. NBP1543820


Add to cart

Description

Description

TIMM44 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

TIMM44
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
TIMM44
Synthetic peptides corresponding to TIMM44(translocase of inner mitochondrial membrane 44 homolog (yeast)) The peptide sequence was selected from the N terminal of TIMM44. Peptide sequence MAAAALRSGWCRCPRRCLGSGIQFLSSHNLPHGSTYQMRRPGGELPLSKS
51 kDa
20ul
Core ESC Like Genes, Stem Cell Markers
Primary
10469
Human
Western Blot
Western Blot 1:100-1:2000
O43615
MIMT44, mitochondrial import inner membrane translocase subunit TIM44, mitochondrial inner membrane translocase, TIM44DKFZp686H05241, translocase of inner mitochondrial membrane 44 homolog (yeast)
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
This product is specific to Subunit or Isoform: TIM44.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit