Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TIMM44 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | TIMM44 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP154381
|
Novus Biologicals
NBP154381 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
TIMM44 Polyclonal specifically detects TIMM44 in Human samples. It is validated for Western Blot.Specifications
| TIMM44 | |
| Polyclonal | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| O43615 | |
| 10469 | |
| Synthetic peptides corresponding to TIMM44(translocase of inner mitochondrial membrane 44 homolog (yeast)) The peptide sequence was selected from the N terminal of TIMM44. Peptide sequence MAAAALRSGWCRCPRRCLGSGIQFLSSHNLPHGSTYQMRRPGGELPLSKS | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. | |
| 51 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| MIMT44, mitochondrial import inner membrane translocase subunit TIM44, mitochondrial inner membrane translocase, TIM44DKFZp686H05241, translocase of inner mitochondrial membrane 44 homolog (yeast) | |
| TIMM44 | |
| IgG | |
| Affinity Purified | |
| This product is specific to Subunit or Isoform: TIM44. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title