Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TIMM44 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen TIMM44
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP154381
View Documents
Novus Biologicals
NBP154381
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

TIMM44 Polyclonal specifically detects TIMM44 in Human samples. It is validated for Western Blot.
Specifications

Specifications

TIMM44
Polyclonal
Rabbit
Core ESC Like Genes, Stem Cell Markers
O43615
10469
Synthetic peptides corresponding to TIMM44(translocase of inner mitochondrial membrane 44 homolog (yeast)) The peptide sequence was selected from the N terminal of TIMM44. Peptide sequence MAAAALRSGWCRCPRRCLGSGIQFLSSHNLPHGSTYQMRRPGGELPLSKS
Primary
Store at -20C. Avoid freeze-thaw cycles.
51 kDa
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
MIMT44, mitochondrial import inner membrane translocase subunit TIM44, mitochondrial inner membrane translocase, TIM44DKFZp686H05241, translocase of inner mitochondrial membrane 44 homolog (yeast)
TIMM44
IgG
Affinity Purified
This product is specific to Subunit or Isoform: TIM44.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit