Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TIN-Ag Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
| Antigen | TIN-Ag |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15696820
|
Novus Biologicals
NBP15696820UL |
20 μL |
Each for $204.00
|
|
|||||
|
NBP156968
|
Novus Biologicals
NBP156968 |
100 μL |
Each for $482.50
|
|
|||||
Description
TIN-Ag Polyclonal specifically detects TIN-Ag in Human samples. It is validated for Western Blot.Specifications
| TIN-Ag | |
| Polyclonal | |
| Rabbit | |
| Q9UJW2 | |
| 27283 | |
| Synthetic peptides corresponding to TINAG (tubulointerstitial nephritis antigen) The peptide sequence was selected from the middle region of TINAG. Peptide sequence VAADRIAIQSKGRYTANLSPQNLISCCAKNRHGCNSGSIDRAWWYLRKRG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| TIN1, TIN2, TIN-AG, tubulointerstitial nephritis antigen | |
| TINAG | |
| IgG |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title