Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TLE1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310280100UL
Description
TLE1 Polyclonal specifically detects TLE1 in Mouse samples. It is validated for Western Blot.Specifications
TLE1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
E(Sp1) homolog, enhancer of split groucho 1, ESG, ESG1Enhancer of split groucho-like protein 1, GRG1, transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila), transducin-like enhancer of split 1, homolog of Drosophila E(sp1), transducin-like enhancer protein 1 | |
The immunogen is a synthetic peptide directed towards the middle region of mouse TLE1 (NP_001272459.1). Peptide sequence VPDSLRSTDKRRNGPEFSSDIKKRKVDDKDNYDSDGDKSDDNLVVDVSNE | |
100 μg | |
Signal Transduction | |
7088 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Mouse | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction