TLR6 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 3 publications

Supplier:  Novus Biologicals NBP154336

Catalog No. NBP154336

Description

TLR6 Polyclonal specifically detects TLR6 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.

Specifications

• Antigen: TLR6
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500, Immunohistochemistry-Frozen 1:10-1:500
• Gene Accession No.: Q2NKL3
• Gene Symbols: TLR6
• Immunogen: Synthetic peptides corresponding to TLR6(toll-like receptor 6) The peptide sequence was selected from the middle region of TLR6. Peptide sequence KCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYSKTTLKALTIEHIT.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with 0.09% Sodium Azide
• Gene Alias: CD286, CD286 antigen, toll-like receptor 6
• Host Species: Rabbit
• Molecular Weight of Antigen: 53 kDa
• Quantity: 100 μL
• Research Discipline: Adaptive Immunity, Cytokine Research, Immunology, Innate Immunity, Prostate Cancer, Toll Like Receptors
• Gene ID (Entrez): 10333
• Target Species: Human, Mouse, Rat, Goat, Sheep
• Isotype: IgG