Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TM2D2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP17984520UL

 View more versions of this product

Catalog No. NBP17984520


Add to cart

Description

Description

TM2D2 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

TM2D2
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
TM2D2
Synthetic peptide directed towards the middle region of human TM2D2The immunogen for this antibody is TM2D2. Peptide sequence QELGYGCLKFGGQAYSDVEHTSVQCHALDGIECASPRTFLRENKPCIKYT.
23 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Western Blot
Western Blot 1:1000
NP_510882
BBP-like protein 1, Beta-amyloid-binding protein-like protein 1, BLP1MGC125814, MGC125813, TM2 domain containing 2, TM2 domain-containing protein 2
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
83877
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit