TM2D2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179845

Catalog No. NBP179845

Description

TM2D2 Polyclonal specifically detects TM2D2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TM2D2
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_510882
• Gene Symbols: TM2D2
• Immunogen: Synthetic peptide directed towards the middle region of human TM2D2The immunogen for this antibody is TM2D2. Peptide sequence QELGYGCLKFGGQAYSDVEHTSVQCHALDGIECASPRTFLRENKPCIKYT.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 83877
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: BBP-like protein 1, Beta-amyloid-binding protein-like protein 1, BLP1MGC125814, MGC125813, TM2 domain containing 2, TM2 domain-containing protein 2
• Host Species: Rabbit
• Molecular Weight of Antigen: 23 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Zebrafish: 77% Chicken: 76%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish
• Isotype: IgG