Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TM2D2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen TM2D2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP17984520
View Documents
Novus Biologicals
NBP17984520UL
20 μL
Each for $152.22
Add to cart
 
NBP179845
View Documents
Novus Biologicals
NBP179845
100 μL
Each for $436.00
Add to cart
 
Description

Description

TM2D2 Polyclonal specifically detects TM2D2 in Human samples. It is validated for Western Blot.
Specifications

Specifications

TM2D2
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
BBP-like protein 1, Beta-amyloid-binding protein-like protein 1, BLP1MGC125814, MGC125813, TM2 domain containing 2, TM2 domain-containing protein 2
TM2D2
IgG
Affinity Purified
23 kDa
Western Blot
Unconjugated
RUO
NP_510882
83877
Synthetic peptide directed towards the middle region of human TM2D2The immunogen for this antibody is TM2D2. Peptide sequence QELGYGCLKFGGQAYSDVEHTSVQCHALDGIECASPRTFLRENKPCIKYT.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit