Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TM7SF2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18054820UL
Description
TM7SF2 Polyclonal specifically detects TM7SF2 in Human samples. It is validated for Western Blot.Specifications
TM7SF2 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_003264 | |
TM7SF2 | |
Synthetic peptide directed towards the N terminal of human TM7SF2. Peptide sequence LAARSGPARLLGPPASLPGLEVLWSPRALLLWLAWLGLQAALYLLPARKV. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
ANG1, C-14 sterol reductase, delta(14)-sterol reductase, delta-14-SR, DHCR14A, NET47, putative sterol reductase SR-1, sterol C14-reductase, transmembrane 7 superfamily member 2 | |
Rabbit | |
Affinity Purified | |
RUO | |
7108 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title