Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMC2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | TMC2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP159417
|
Novus Biologicals
NBP159417 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
TMC2 Polyclonal specifically detects TMC2 in Human samples. It is validated for Western Blot.Specifications
| TMC2 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| C20orf145, dJ686C3.3, transmembrane channel-like 2, transmembrane channel-like protein 2, Transmembrane cochlear-expressed protein 2, transmembrane, cochlear expressed, 2 | |
| TMC2 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8TDI7 | |
| 117532 | |
| Synthetic peptides corresponding to TMC2(transmembrane channel-like 2) The peptide sequence was selected from the middle region of TMC2. Peptide sequence YCWCWDLEAGFPSYAEFDISGNVLGLIFNQGMIWMGSFYAPGLVGINVLR. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title