Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMCC3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
| Antigen | TMCC3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP19133820
|
Novus Biologicals
NBP19133820UL |
20 μL |
Each for $204.00
|
|
|||||
|
NBP191338
|
Novus Biologicals
NBP191338 |
100 μL |
Each for $482.50
|
|
|||||
Description
TMCC3 Polyclonal specifically detects TMCC3 in Human samples. It is validated for Western Blot.Specifications
| TMCC3 | |
| Polyclonal | |
| Rabbit | |
| NP_065749 | |
| 57458 | |
| Synthetic peptide directed towards the N terminal of human TMCC3. Peptide sequence MPGSDTALTVDRTYSDPGRHHRCKSRVERHDMNTLSLPLNIRRGGSDTNL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| KIAA1145, transmembrane and coiled-coil domain family 3, transmembrane and coiled-coil domains 3, transmembrane and coiled-coil domains protein 3 | |
| TMCC3 | |
| IgG |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title