Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMCO3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | TMCO3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
TMCO3 Polyclonal specifically detects TMCO3 in Mouse samples. It is validated for Western Blot.Specifications
TMCO3 | |
Polyclonal | |
Rabbit | |
NP_758486 | |
55002 | |
The immunogen for this antibody is Tmco3. Peptide sequence MLIDSQNNQYILTKPRDSTIPRADHHFIKDIVTIGMLSLPCGWLCTAIGL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
B230339H12Rik, C13orf11, chromosome 13 open reading frame 11, FLJ20623, Putative LAG1-interacting protein, transmembrane and coiled-coil domain-containing protein 3, transmembrane and coiled-coil domains 3 | |
TMCO3 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title