Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TMCO3 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP179207

 View more versions of this product

Catalog No. NBP179207


Add to cart

Description

Description

TMCO3 Polyclonal antibody specifically detects TMCO3 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish samples. It is validated for Western Blot.
Specifications

Specifications

TMCO3
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
TMCO3
The immunogen for this antibody is Tmco3. Peptide sequence MLIDSQNNQYILTKPRDSTIPRADHHFIKDIVTIGMLSLPCGWLCTAIGL.
Immunogen affinity purified
RUO
Primary
55002
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:1000
NP_758486
B230339H12Rik, C13orf11, chromosome 13 open reading frame 11, FLJ20623, Putative LAG1-interacting protein, transmembrane and coiled-coil domain-containing protein 3, transmembrane and coiled-coil domains 3
Rabbit
IgG
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Chicken: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Canine: 92%; Guinea pig: 92%; Equine: 92%; Rabbit: 92%; Zebrafish: 92%; Bovine: 85%.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit