TMCO4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP168907

Catalog No. NBP168907

Description

TMCO4 Polyclonal specifically detects TMCO4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TMCO4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp686C23231, RP5-1056L3.6, transmembrane and coiled-coil domain-containing protein 4, transmembrane and coiled-coil domains 4
• Host Species: Rabbit
• Molecular Weight of Antigen: 68 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Zebrafish: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q5TGY1
• Gene Symbols: TMCO4
• Immunogen: Synthetic peptides corresponding to TMCO4 (transmembrane and coiled-coil domains 4) The peptide sequence was selected from the C terminal of TMCO4. Peptide sequence WPASLLSVANVIDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVTLIGFS.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 255104
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.