Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMED1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | TMED1 |
---|---|
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Regulatory Status | RUO |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP162557
|
Novus Biologicals
NBP162557 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
TMED1 Polyclonal specifically detects TMED1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
TMED1 | |
Unconjugated | |
RUO | |
Il1rl1l, IL1RL1LGIL1RL1-binding protein, interleukin 1 receptor-like 1 ligand, Interleukin-1 receptor-like 1 ligand, MGC1270, Putative T1/ST2 receptor-binding protein, ST2L, T1/ST2 receptor binding protein, transmembrane emp24 domain containing 1, transmembrane emp24 domain-containing protein 1, transmembrane emp24 protein transport domain containing 1 | |
TMED1 | |
IgG | |
23 kDa |
Polyclonal | |
Rabbit | |
Q13445 | |
11018 | |
Synthetic peptides corresponding to TMED1(transmembrane emp24 protein transport domain containing 1) The peptide sequence was selected from the middle region of TMED1. Peptide sequence FTLESPQGVLLVSESRKADGVHTVEPTEAGDYKLCFDNSFSTISEKLVFF. | |
Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title