Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TMED1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen TMED1
Dilution Western Blot 1.0 ug/ml, Aggregation
Applications Western Blot, Aggregation
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB124898
View Documents
Novus Biologicals
NBP30999825UL
25 μg
Each for $106.19
Add to cart
 
NB124897
View Documents
Novus Biologicals
NBP309998100UL
100 μg
Each for $352.89
Add to cart
 
Description

Description

TMED1 Polyclonal antibody specifically detects TMED1 in Mouse samples. It is validated for Western Blot, Aggregation
Specifications

Specifications

TMED1
Western Blot, Aggregation
Purified
RUO
PBS buffer, 2% sucrose
11018
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml, Aggregation
Unconjugated
Rabbit
Mouse
Il1rl1l, IL1RL1LGIL1RL1-binding protein, interleukin 1 receptor-like 1 ligand, Interleukin-1 receptor-like 1 ligand, MGC1270, Putative T1/ST2 receptor-binding protein, ST2L, T1/ST2 receptor binding protein, transmembrane emp24 domain containing 1, transmembrane emp24 domain-containing protein 1, transmembrane emp24 protein transport domain containing 1
The immunogen is a synthetic peptide directed towards the C terminal region of human TMED1 (NP_034874.2). Peptide sequence MEDIKESIETMRTRLERSIQMLTLLRAFEARDRNLQEDNLERVNFWSAAN
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit