Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMEM106C Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | TMEM106C |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP159829
|
Novus Biologicals
NBP159829 |
100 μL |
Each of 1 for $436.00
|
|
Description
TMEM106C Polyclonal specifically detects TMEM106C in Human samples. It is validated for Western Blot.Specifications
TMEM106C | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
EMOC, Endoplasmic reticulum membrane protein overexpressed in cancer, MGC111210, MGC5576, transmembrane protein 106C | |
TMEM106C | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
Q9BVX2 | |
79022 | |
Synthetic peptides corresponding to TMEM106C(transmembrane protein 106C) The peptide sequence was selected from the middle region of TMEM106C. Peptide sequence NFYTVAVTSLSSQIQYMNTVVSTYVTTNVSLIPPRSEQLVNFTGKAEMGG. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title