Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMEM109 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | TMEM109 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP191346
|
Novus Biologicals
NBP191346 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
TMEM109 Polyclonal specifically detects TMEM109 in Human samples. It is validated for Western Blot.Specifications
TMEM109 | |
Polyclonal | |
Purified | |
RUO | |
transmembrane protein 109 | |
TMEM109 | |
IgG | |
Protein A purified |
Western Blot | |
Unconjugated | |
Rabbit | |
NP_076997 | |
79073 | |
Synthetic peptide directed towards the middle region of human TMEM109. Peptide sequence GIAAQLLNALGLAGDYLAQGLKLSPGQVQTFLLWGAGALVVYWLLSLLLG. | |
Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title