Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMEM132D Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
Antigen | TMEM132D |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP19136620
|
Novus Biologicals
NBP19136620UL |
20 μL |
Each for $204.00
|
|
|||||
NBP191366
|
Novus Biologicals
NBP191366 |
100 μL |
Each for $482.50
|
|
|||||
Description
TMEM132D Polyclonal specifically detects TMEM132D in Mouse samples. It is validated for Western Blot.Specifications
TMEM132D | |
Polyclonal | |
Rabbit | |
NP_766473 | |
121256 | |
The specific Immunogen is proprietary information. Peptide sequence QRPKQEAAISCWVQFSDGSVTPLDIYDEKDFSLMATSLDEKVVSILQDPK. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
HBE120, KIAA1944, mature OL transmembrane protein, mature oligodendrocytes transmembrane protein, MGC138770, MGC138771, MOLT, transmembrane protein 132D | |
TMEM132D | |
IgG |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title