Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TMEM139 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen TMEM139
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP170726
View Documents
Novus Biologicals
NBP170726
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

TMEM139 Polyclonal specifically detects TMEM139 in Human samples. It is validated for Western Blot.
Specifications

Specifications

TMEM139
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
FLJ90586, transmembrane protein 139
TMEM139
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
Q8IV31
135932
Synthetic peptides corresponding to TMEM139 (transmembrane protein 139) The peptide sequence was selected from the N terminal of TMEM139. Peptide sequence ITPVAYFFLTLGGFFLFAYLLVRFLEWGLRSQLQSMQTESPGPSGNARDN.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit