Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMEM141 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP179868
Description
TMEM141 Polyclonal specifically detects TMEM141 in Human samples. It is validated for Western Blot.Specifications
TMEM141 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
NP_116317 | |
TMEM141 | |
The immunogen for this antibody is TMEM141. Peptide sequence PLQWSLLVAVVAGSVVSYGVTRVESEKCNNLWLFLETGQLPKDRSTDQRS. | |
Affinity Purified | |
RUO | |
85014 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
MGC14141, RP11-216L13.7, transmembrane protein 141 | |
Rabbit | |
12 kDa | |
100 μL | |
Primary | |
This product recognizes Human Predicted Homology Based On Immunogen Sequence:. Bovine: 79%. | |
Human, Mouse, Bovine | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title