Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMEM141 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | TMEM141 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179868
|
Novus Biologicals
NBP179868 |
100 μL |
Each of 1 for $436.00
|
|
Description
TMEM141 Polyclonal specifically detects TMEM141 in Human samples. It is validated for Western Blot.Specifications
TMEM141 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
MGC14141, RP11-216L13.7, transmembrane protein 141 | |
TMEM141 | |
IgG | |
Affinity Purified | |
12 kDa |
Western Blot | |
Unconjugated | |
RUO | |
NP_116317 | |
85014 | |
The immunogen for this antibody is TMEM141. Peptide sequence PLQWSLLVAVVAGSVVSYGVTRVESEKCNNLWLFLETGQLPKDRSTDQRS. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title