Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TMEM147 Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$165.00 - $436.00

Specifications

Antigen TMEM147
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP17933420
View Documents
Novus Biologicals
NBP17933420UL
20 μL
Each for $165.00
Add to cart
 
NBP179334
View Documents
Novus Biologicals
NBP179334
100 μL
Each for $436.00
Add to cart
 
Description

Description

TMEM147 Polyclonal specifically detects TMEM147 in Rat samples. It is validated for Western Blot.
Specifications

Specifications

TMEM147
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
MGC1936, NIFIE14, Protein NIFIE 14, seven transmembrane domain protein, transmembrane protein 147
TMEM147
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
NP_001033583
10430
The immunogen for this antibody is Tmem147. Peptide sequence VTYLFVQLCKMLFLATFFPTWEGGIYDFIGEFMKASVDVADLIGLNLVMS.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit