Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMEM147 Rabbit anti-Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$165.00 - $436.00
Specifications
| Antigen | TMEM147 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17933420
|
Novus Biologicals
NBP17933420UL |
20 μL |
Each for $165.00
|
|
NBP179334
|
Novus Biologicals
NBP179334 |
100 μL |
Each for $436.00
|
|
Description
TMEM147 Polyclonal specifically detects TMEM147 in Rat samples. It is validated for Western Blot.Specifications
| TMEM147 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| MGC1936, NIFIE14, Protein NIFIE 14, seven transmembrane domain protein, transmembrane protein 147 | |
| TMEM147 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_001033583 | |
| 10430 | |
| The immunogen for this antibody is Tmem147. Peptide sequence VTYLFVQLCKMLFLATFFPTWEGGIYDFIGEFMKASVDVADLIGLNLVMS. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title