Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMEM150B Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310200100UL
Description
TMEM150B Polyclonal specifically detects TMEM150B in Mouse samples. It is validated for Western Blot.Specifications
TMEM150B | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
hCG1651476, TMEM224, Transmembrane Protein 150B, Transmembrane Protein 224, Transmembrane Protein LOC284417 | |
The immunogen is a synthetic peptide directed towards the middle region of mouse TMEM150B (NP_001136264.1). Peptide sequence GTSIVGNFQDKNQKPTHLAGAFLAFILGNLYFWLQFFLSWWVKGLPQPGP | |
100 μg | |
Primary | |
Mouse | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
284417 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction