Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMEM200B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | TMEM200B |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP191575
|
Novus Biologicals
NBP191575 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
TMEM200B Polyclonal specifically detects TMEM200B in Human samples. It is validated for Western Blot.Specifications
TMEM200B | |
Polyclonal | |
Rabbit | |
NP_001003682 | |
399474 | |
Synthetic peptide directed towards the N terminal of human TTMB. Peptide sequence AGYWPHRAGAPGSRAANASSPQMSELRREGRGGGRAHGPHERLRLLGPVI. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
transmembrane protein 200B | |
TMEM200B | |
IgG |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title