Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMEM30B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
| Antigen | TMEM30B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15953420
|
Novus Biologicals
NBP15953420UL |
20 μL |
Each for $204.00
|
|
|||||
|
NBP159534
|
Novus Biologicals
NBP159534 |
100 μL |
Each for $482.50
|
|
|||||
Description
TMEM30B Polyclonal specifically detects TMEM30B in Human samples. It is validated for Western Blot.Specifications
| TMEM30B | |
| Polyclonal | |
| Rabbit | |
| Q3MIR4 | |
| 161291 | |
| Synthetic peptides corresponding to TMEM30B(transmembrane protein 30B) The peptide sequence was selected from the middle region of TMEM30B. Peptide sequence VYLYYELTNFYQNNRRYGVSRDDAQLSGLPSALRHPVNECAPYQRSAAGL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| cell cycle control protein 50B, transmembrane protein 30BCDC50BMGC126775 | |
| TMEM30B | |
| IgG |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title