Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TMEM57 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen TMEM57
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15970920
View Documents
Novus Biologicals
NBP15970920UL
20 μL
Each for $152.22
Add to cart
 
NBP159709
View Documents
Novus Biologicals
NBP159709
100 μL
Each for $436.00
Add to cart
 
Description

Description

TMEM57 Polyclonal specifically detects TMEM57 in Human samples. It is validated for Western Blot.
Specifications

Specifications

TMEM57
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
FLJ23007, MACOILIN, transmembrane protein 57FLJ10747
TMEM57
IgG
Affinity Purified
76 kDa
Western Blot
Unconjugated
RUO
Q8N5G2
55219
Synthetic peptides corresponding to TMEM57(transmembrane protein 57) The peptide sequence was selected from the N terminal of TMEM57. Peptide sequence VVWALVLLADFVLEFRFEYLWPFWLFIRSVYDSFRYQGLAFSVFFVCVAF.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit