Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMEM63B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19155520UL
Description
TMEM63B Polyclonal specifically detects TMEM63B in Human samples. It is validated for Western Blot.Specifications
TMEM63B | |
Polyclonal | |
Western Blot 1:1000 | |
NP_060896 | |
TMEM63B | |
Synthetic peptide directed towards the middle region of human TMEM63B. Peptide sequence VRGCEQVEAIEYYTKLEQKLKEDYKREKEKVNEKPLGMAFVTFHNETITA. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
transmembrane protein 63B | |
Rabbit | |
Affinity Purified | |
RUO | |
55362 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction