Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMEM74 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | TMEM74 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP160092
|
Novus Biologicals
NBP160092 |
100 μL |
Each of 1 for $436.00
|
|
Description
TMEM74 Polyclonal specifically detects TMEM74 in Human samples. It is validated for Western Blot.Specifications
TMEM74 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
FLJ30668, NET36, transmembrane protein 74 | |
TMEM74 | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
Q96NL1 | |
157753 | |
Synthetic peptides corresponding to TMEM74(transmembrane protein 74) The peptide sequence was selected from the middle region of TMEM74. Peptide sequence ERLEKESARLGAHLDRCVIAGLCLLTLGGVILSCLLMMSMWKGELYRRNR. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title