Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMEM91 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | TMEM91 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP170730
|
Novus Biologicals
NBP170730 |
100 μL |
Each of 1 for $436.00
|
|
Description
TMEM91 Polyclonal specifically detects TMEM91 in Human samples. It is validated for Western Blot.Specifications
TMEM91 | |
Polyclonal | |
Purified | |
RUO | |
IFITMD6, interferon induced transmembrane protein domain containing 6, transmembrane protein 91 | |
TMEM91 | |
IgG | |
Protein A purified |
Western Blot | |
Unconjugated | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
641649 | |
Synthetic peptides corresponding to TMEM91(transmembrane protein 91) The peptide sequence was selected from the N terminal of TMEM91. Peptide sequence SPPLPSVSAGLGEPRPPDVEDMSSSDSDSDWDGGSRLSPFLPHDHLGLAV. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title