Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TMEM91 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen TMEM91
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Form Purified
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP170730
View Documents
Novus Biologicals
NBP170730
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

TMEM91 Polyclonal specifically detects TMEM91 in Human samples. It is validated for Western Blot.
Specifications

Specifications

TMEM91
Polyclonal
Purified
RUO
IFITMD6, interferon induced transmembrane protein domain containing 6, transmembrane protein 91
TMEM91
IgG
Protein A purified
Western Blot
Unconjugated
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
641649
Synthetic peptides corresponding to TMEM91(transmembrane protein 91) The peptide sequence was selected from the N terminal of TMEM91. Peptide sequence SPPLPSVSAGLGEPRPPDVEDMSSSDSDSDWDGGSRLSPFLPHDHLGLAV.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit